PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0055s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 501aa    MW: 55054.1 Da    PI: 7.0418
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0055s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.98.6e-33179237160
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                          ldDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  +++++ei+Y+g+Hnh+k
  Kalax.0055s0008.1.p 179 LDDGYNWRKYGQKSVKGSENPRSYYKCTFTNCPTKKKVERSL-EGHITEIVYKGSHNHPK 237
                          59****************************************.***************85 PP

2WRKY105.92.1e-33334392159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d k v++tYeg+Hnh+
  Kalax.0055s0008.1.p 334 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFVGCPVRKHVERASQDLKSVITTYEGKHNHD 392
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.652174238IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.6E-28175238IPR003657WRKY domain
SuperFamilySSF1182907.19E-25177238IPR003657WRKY domain
SMARTSM007741.5E-35179237IPR003657WRKY domain
PfamPF031061.3E-24180236IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.1E-37319394IPR003657WRKY domain
SuperFamilySSF1182904.58E-29326394IPR003657WRKY domain
PROSITE profilePS5081137.654329394IPR003657WRKY domain
SMARTSM007742.4E-38334393IPR003657WRKY domain
PfamPF031061.4E-25335392IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MDNGGGGWEL QTSSSNTDGV PKFKSFLPPS LQPTSLFSPT SSFLNSFSPS QFLDSPVLFS  60
STSNVLASPT TGTFDWRNSS LDAMKAEQDE NNYSNFSFQP QTTSSIYDQQ TSAAFMDDTM  120
SKQLEWSFNT HPKQTDLSSN VIQTVAQAES RPMQTNSNMQ NGTAVASSGT NIGGKQRRLD  180
DGYNWRKYGQ KSVKGSENPR SYYKCTFTNC PTKKKVERSL EGHITEIVYK GSHNHPKPQS  240
TRRSSSSSLY GCCESENGRT ESGGTPENSS TSMGEDEFEH GSPLSKSGDD NDVNEPDSKR  300
WKGENEIESA AGSGSRTVRE PRIVVQTTSE IDILDDGYRW RKYGQKVVKG NPNPRSYYKC  360
TFVGCPVRKH VERASQDLKS VITTYEGKHN HDVPAARGSH SYSMIKSSSS ANAPLAIRPT  420
AATVSSANHT SNYSNSLQAS RPSTQAPFTL EMMQDPGSFG FSGFGKPSCN YGSQPQTDSF  480
FSRAKEEPKD DQFFFDQFLS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-37166395478Probable WRKY transcription factor 4
2lex_A3e-37166395478Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026547.11e-165RNI-like superfamily protein
SwissprotQ8S8P51e-128WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A061EXQ11e-165A0A061EXQ1_THECC; RNI-like superfamily protein
TrEMBLA0A0M4PNU91e-166A0A0M4PNU9_9MAGN; Transcription factor WRKY33
STRINGPOPTR_0016s13600.11e-155(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-126WRKY DNA-binding protein 33